PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00082025001
Common NameGSBRNA2T00082025001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 177aa    MW: 20741.7 Da    PI: 10.3172
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00082025001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like461.1e-1460109555
              G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           Wt+e H +F++a++ L G e   Pk+il +m+v++Lt  +v+ HL  Y+ 
  GSBRNA2T00082025001  60 LWTCENHLKFLSAISYL-GDEDSHPKSILSIMNVPSLTHREVARHLESYKA 109
                          5****************.9999**************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.2E-1054113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-1359114IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-1260110IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MLQHVLPNKS QKLEKLSIPN NAEDVSEVRI NQMKAFRENL RRQRTEVNNI ESKVRRRSNL  60
WTCENHLKFL SAISYLGDED SHPKSILSIM NVPSLTHREV ARHLESYKAK VDRMNETLSR  120
KEWIPTNKTF EYPSDYKYPF TLSNIAKQKN SGKNLIRERD TKLKFYLGGQ MDLSFI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894892e-95AC189489.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084K02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591135.11e-128PREDICTED: putative two-component response regulator-like APRR6
SwissprotQ9C9F68e-40APRR6_ARATH; Putative two-component response regulator-like APRR6
TrEMBLA0A078JNA81e-129A0A078JNA8_BRANA; BnaCnng61430D protein
TrEMBLA0A0D3CYY01e-129A0A0D3CYY0_BRAOL; Uncharacterized protein
STRINGBra004289.1-P5e-38(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136851424
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.15e-41pseudo-response regulator 6
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]